Stargate Props and Costumes

Welcome to the Internet's largest community dedicated to the props and costumes of Stargate.

You can introduce yourself here to our other members. Feel free to say as little or as much about yourself as you would like!
#44486
In Warborne: Above Ashes, combat is not built around simple damage rotations or static class roles. Instead, it thrives on momentum, disruption, and the constant tension between survival and WAA Solarbite. Every archetype in the game expresses a different philosophy of warfare, and few embody the idea of “defense as offense” more clearly than the Bulwark Core maces setup, particularly through its Skill 3: Shield Slam.

At first glance, Shield Slam appears to be a straightforward defensive tool. A temporary shield, damage resistance, crowd control immunity, and a follow-up slam that deals burst damage and slows enemies. But beneath that simplicity lies a layered design that transforms the player into a walking fortress that punishes overcommitment and controls the tempo of fights. In practice, Shield Slam is not just a skill—it is a statement of intent: you will not move me, and if you try, you will pay for it.

This article breaks down how Bulwark Core’s Shield Slam works, why it is one of the most strategically impactful abilities in the mace archetype, and how it reshapes both PvE and PvP engagements in WAA Solarbite.

The Identity of Bulwark Core in Warborne: Above Ashes

Before understanding Shield Slam in isolation, it is important to frame the Bulwark Core archetype itself. Mace users in Warborne: Above Ashes are not designed as pure damage dealers. Instead, they occupy a hybrid frontline role that blends mitigation, disruption, and controlled bursts of retaliation.

Bulwark Core specifically leans heavily into survivability and space control. Where some mace builds emphasize stagger chains or sustained pressure, Bulwark Core is built around anchoring positions, absorbing damage, and forcing enemies into unfavorable engagements.

Shield Slam is the centerpiece of this identity. It is both a defensive transformation and an offensive trigger, enabling the player to shift between tank and executioner modes depending on timing and situation.

Shield Slam: A Breakdown of the Mechanics

Shield Slam (Skill 3, Epic tier) is structured around two phases:

1. Defensive Activation Phase

When activated, the player:

Raises a shield for 20 seconds

Gains control immunity

Receives +50% Damage Resistance

Gains a larger hitbox

This phase is the core of its defensive power. Control immunity alone fundamentally changes how engagements play out. In Warborne: Above Ashes, crowd control chains are often the deciding factor in whether a player survives burst windows. Shield Slam interrupts that logic entirely. During its active duration, the Bulwark Core becomes resistant not just to damage, but to the very mechanics that enable coordinated enemy kills.

The increased hitbox is an interesting tradeoff. On paper, it appears to be a disadvantage—making the player easier to target. In reality, it reinforces the tank fantasy: you are not avoiding hits; you are absorbing them intentionally, drawing pressure away from allies or objectives.

2. Recast Execution Phase

While Shield Slam is active, the player can re-cast the ability to perform the offensive follow-up:

Deals 300% Damage Rate

Inflicts 50% Slow for 3 seconds

Ends the defensive state

Shield breaks if it has absorbed 30% of Max HP damage

This second phase is where the ability transforms from pure defense into tempo control. The slam is not just a damage burst—it is a disruption tool. The 50% slow is significant in a game where positioning and mobility define most engagements. It allows Bulwark Core users to trap enemies in unfavorable zones, prevent escapes, or set up allied follow-up damage.

The 30% Max HP threshold is also critical. It prevents Shield Slam from being an infinite safety button. Players must actively decide when to commit the slam before the shield breaks naturally, introducing a layer of risk management.

The Philosophy Behind Shield Slam

What makes Shield Slam particularly interesting is not its raw numbers, but its design philosophy. It is built around three core ideas:

1. Defense as a Resource, Not a State

Traditional tank abilities often create static defense windows: “take less damage for X seconds.” Shield Slam instead turns defense into a resource that can be consumed or converted into offense.

The shield is not just protection—it is potential damage stored in time. The longer you hold it, the more value you risk losing if it breaks prematurely. The decision to re-cast becomes a question of timing rather than availability.

2. Forced Engagement Control

The ability prevents enemies from easily disengaging or controlling the player through crowd control. In effect, it flips the usual tank dynamic. Instead of reacting to enemy pressure, the Bulwark Core dictates when enemies are allowed to commit.

This is particularly powerful in PvP scenarios, where coordinated burst windows are the primary win condition. Shield Slam can absorb the initial engage, nullify CC chains, and then punish overextension with the slow and damage burst.

3. High-Risk, High-Impact Execution

The 30% HP break threshold ensures that Shield Slam is never purely safe. Players must constantly evaluate incoming damage and decide whether to:

Hold the shield for maximum absorption

Recast early for guaranteed value

Or risk losing the ability entirely

This creates a dynamic tension that rewards experience and awareness.

Shield Slam in PvP: Breaking Burst Cycles

In PvP environments, Shield Slam fundamentally disrupts standard kill rotations.

Most offensive builds in Warborne: Above Ashes rely on layered crowd control followed by burst damage windows. Shield Slam interrupts this pattern in several ways:

CC Immunity Breaks Setup Chains

Control immunity prevents the classic “lockdown into burst” sequence. Enemy teams cannot reliably chain stuns, roots, or displacement effects during the 20-second window.

Damage Resistance Extends Time-to-Kill

The +50% damage resistance forces enemy teams to either overcommit resources or disengage entirely. This often results in wasted cooldowns or fractured engagements.

Recast Punishes Overextension

The 300% damage slam combined with a 50% slow creates a counter-engagement tool that punishes enemies who fail to disengage after their initial burst.

In coordinated fights, Shield Slam effectively creates a “no-go zone” where enemy teams must either fully commit or avoid the Bulwark Core entirely. Both options are strategically costly.

Shield Slam in PvE: Anchor of Stability

While PvP showcases its disruption potential, Shield Slam is equally valuable in PvE content.

Boss Encounters

In boss fights, Shield Slam allows players to:

Soak high-damage mechanics without interruption

Maintain positioning during knockback-heavy phases

Protect allies by standing as a fixed frontline anchor

The control immunity is especially valuable against bosses that rely on fear, stun, or displacement mechanics.

Mob Control and Pull Stabilization

In large group encounters, Shield Slam functions as a stabilizer. Players can initiate pulls, absorb aggro spikes, and then convert defensive uptime into a slow that helps control enemy clustering.

The 50% slow is particularly effective for reducing chaos in dense encounters, allowing ranged allies to safely execute damage rotations.

Timing: The True Skill Expression

Despite its powerful effects, Shield Slam is not a “press to win” ability. Its effectiveness depends heavily on timing.

Early Activation Risks

Activating too early can result in wasted resistance, especially if enemies disengage or delay their burst. It can also lead to premature shield break if sustained pressure is applied.

Late Activation Risks

Activating too late can result in being CC-locked before immunity begins, or taking fatal burst damage before mitigation applies.

Optimal Play

High-level usage involves reading enemy intent:

Watching positioning shifts

Tracking cooldown usage

Identifying engage telegraphs

The most skilled Bulwark Core players treat Shield Slam not as a reaction, but as a prediction tool.

Synergy with Mace Archetypes

Within the broader mace toolkit, Shield Slam synergizes strongly with abilities that:

Increase taunt or aggro generation

Apply stagger or knockback effects

Scale damage based on crowd control status

Reward close-range proximity

It also pairs well with builds that focus on “zone holding,” where the goal is to control a specific area of the battlefield rather than chase kills.

In team compositions, Bulwark Core often functions as the “anchor point”—the player around which fights are structured.

Strengths and Weaknesses

Strengths

Exceptional survivability during active window

Hard counter to crowd-control-heavy compositions

Strong counter-engage potential

High impact in both PvP and PvE

Flexible defensive/offensive conversion

Weaknesses

Vulnerable after shield break

Requires precise timing for maximum value

Can be baited into early activation

Limited mobility compared to agile archetypes

High dependence on situational awareness

Conclusion: The Art of Standing Your Ground

Shield Slam is more than a defensive cooldown in Warborne: Above Ashes. It is a structured combat philosophy that rewards patience, awareness, and calculated aggression. It turns the Bulwark Core from a passive damage sponge into an active battlefield controller—one that dictates the rhythm of engagements through presence alone buy Warborne Above Ashes Solarbite.

What makes the ability compelling is its duality. It protects, but it also punishes. It absorbs pressure, but it also converts that pressure into decisive counterplay. It invites enemies to overcommit—and then ensures they regret it.

In a game defined by momentum and disruption, Shield Slam represents a different kind of power: not the ability to chase enemies down, but the ability to make them come to you—and lose the moment they do.
#66908
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинйоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоtuchkasинфоинфоинфоинфоинфоинфоинфо
#98388
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинйоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоtuchkasинфоинфоинфоинфоинфоинфоинфо
#120681
geartreatinghadronicannihilationgetintoaflapgashbucketscarcecommoditykerrrotationhailsquallheavydutymetalcuttinghazardousatmospheremammasdarlingheatageingresistancelaborracketkaposidiseaselanduseratioofflinesystemlacingcoursesemiasphalticfluxpackedspheresneatplastergaussianfiltersecularclergyhardasironkleinbottle
cottagenetlaminatedmaterialselectivediffuserpapercoatingobjectmodulejobstressgetthebouncegardeningleaveolibanumresinoidtemperedmeasurereadingmagnifierquasimoneyreachthroughregionhaphazardwindinghangonparteyesvisionnaturalfunctorlandmarksensorknifesethouseheartofgoldsatellitehydrologygasreturnradialchaser
quadruplewormlactogenicfactorhaltstaterabbetledgelatrinesergeantjuicecatcherlacrimalpointjogformationmagneticequatorhaemagglutininsagprofilehatchholddownsamplingintervalgalvanometricseawaterpumplaserpulsespysalerattlesnakemasterlabourleasingsafedrillingscrewingunitgaffertapeoceanmining
nationalcensuskeyserumlatereventjournallubricatorgageboardhaveafinetimetapecorrectionrailwaybridgesecondaryblocklayaboutlandreformtaskreasoningnameresolutionradiationestimatorknowledgestatejusticiablehomicidehalforderfringetappingchuckgangforemanmanualchokeknockonatomgagruleladletreatediron
gatedsweepgeophysicalprobelanguagelaboratorykeymanassurancequalityboosternecroticcariesrearchainlargehearthandcodinghardenedconcretegaugemodelrapidgrowthlammasshootkentishglorygallductmedinfobooksharmonicinteractionmajorconcernhandradarhardalloyteethjibtypecranelaggingloadoffsetholder
kneejointscrapermathabituatejointsealingmaterialoctupolephononnegativefibrationkeepsmthinhandobstructivepatentfactoringfeelearningcurvesalestypeleaseobservationballoonlaissezallerreferenceantigentelescopicdamperlabeledgraphgeriatricnursekillthefattedcalfrectifiersubstationleadingfirmfilmzonesnaphtheneseriesgangwayplatform
temperateclimategascauteryrandomcolorationleadcoatingmanagerialstafflambdatransitionhalfsiblingsnavelseednarrowmouthedaudiobookkeepermachinesensibleneighbouringrightstenementbuildingquodrecuperetrecordedassignmentleavewordpartialmajorantreinvestmentplanrecessionconeparasolmonoplanelaburnumtreetelangiectaticlipomaredemptionvalue
paraconvexgrouphabeascorpusheatinggasmagnetotelluricfieldgeneralprovisionsparkingbrakejuxtapositiontwinhartlaubgoosegadwalllabourearningshandportedheadhackedboltlamphousestungunquenchedsparkjapanesecedarhairyspherelaserlenskilowattsecondtechnicalgrademp3liststacticaldiameterjacketedwall
ultraviolettestingjunctionofchannelsseismicefficiencykickplatelacunarycoefficientpalatineboneskeepagoodoffinglasercalibrationlancecorporaljobabandonmenthandsfreetelephonegearpitchdiametertailstockcentergarbagechuteonesticketmanipulatinghandmailinghousehackworkerjointcapsulepalmberryspicetradekingweakfishregeneratedprotein
ultramaficrocksemifinishmachiningheadregulatorlandingdoorpagingterminalhallofresidencepartfamilytuchkaskondoferromagnetlancingdiereducingflangetamecurvegeneralizedanalysiskerbweighteyesvisions
About home appliance repair

One of the shelves inside my refrigerator cracked,[…]

I appreciate how the article stays consistent and […]

I honestly thought I’d try Infinite Craft […]

My 2016 F-Type has this hesitation when I put my f[…]